Brain Play 1st-3rd Grade., Mac OS X, Windows XP, Mac OS X Intel. The Magic School Bus Lands On Mars lets you blast off into outer space with Ms. NCBI Blast+ works even on MacBook. It is assumed that Firefox web browser is installed on your Mac and set as a default browser. If you do not have Firefox, you can download it from here for free. This instruction does not cover all blast derivatives, such as blastx, mega blast or psiblast. Pastebin.com is the number one paste tool since 2002. Pastebin is a website where you can store text online for a set period of time.
Brain Blast Mac Os 11
- Download executables (binary) of blast-commands for Mac OS X.
- ```Bash:
- $ curl -O ftp://ftp.ncbi.nih.gov/blast/executables/blast+/2.2.28/ncbi-blast-2.2.28+.dmg
- $ wget ftp://ftp.ncbi.nih.gov/blast/executables/blast+/2.2.28/ncbi-blast-2.2.28+.dmg
- $ blastp -version
- Package: blast 2.2.28, build Mar 13 2013 10:25:37
- makeblastdb: 2.2.28+
- ```
- Next, download fasta-file to create database for blast.
- $ curl -O ftp://ftp.ncbi.nih.gov/blast/db/FASTA/swissprot.gz
- $ head swissprot
- >gi|13878750|sp|Q9CDN0.1|RS18_LACLA RecName: Full=30S ribosomal protein S18gi|122939895|sp|Q02VU1.1|RS18_LACLS RecName: Full=30S ribosomal protein S18gi|166220956|sp|A2RNZ2.1|RS18_LACLM RecName: Full=30S ribosomal protein S18
- MAQQRRGGFKRRKKVDFIAANKIEVVDYKDTELLKRFISERGKILPRRVTGTSAKNQRKVVNAIKRARVMALLPFVAEDQ
- >gi|1705556|sp|P54670.1|CAF1_DICDI RecName: Full=Calfumirin-1; Short=CAF-1
- MASTQNIVEEVQKMLDTYDTNKDGEITKAEAVEYFKGKKAFNPERSAIYLFQVYDKDNDGKITIKELAGDIDFDKALKEY
- KEKQAKSKQQEAEVEEDIEAFILRHNKDDNTDITKDELIQGFKETGAKDPEKSANFILTEMDTNKDGTITVKELRVYYQK
- >gi|30172867|sp|Q8G5F3.1|ARLY_BIFLO RecName: Full=Argininosuccinate lyase; Short=ASAL; AltName: Full=Arginosuccinasegi|238692068|sp|B3DSY6.1|ARLY_BIFLD RecName: Full=Argininosuccinate lyase; Short=ASAL; AltName: Full=Arginosuccinase
- MTENNEHLALWGGRFTSGPSPELARLSKSTQFDWRLADDDIAGSRAHARALGRAGLLTADELQRMEDALDTLQRHVDDGS
- FAPIEDDEDEATALERGLIDIAGDELGGKLRAGRSRNDQIACLIRMWLRRHSRVIAGLLLDLVNALIEQSEKAGRTVMPG
- Then, create databese for blast form this fasta-file.
- ```Bash:
- $ mkdir -p db/blast/
- $ makeblastdb -in swissprot.fa -dbtype prot -out db/blast/swissprot -hash_index
- swissprot.phd swissprot.phi swissprot.phr swissprot.pin swissprot.pog swissprot.psd swissprot.psi swissprot.psq
- In this example, we will use `blastp`. `blastp` is for,
- query: protein, database: protein.
- Use like following,
- ```Bash:
- >test
- $ blastp -query test.fa -db /path/to/swissprot/swissprot
- ..
- Query= test
- Length=3
- ..
- For option -db, you have to write /path/to/db/,
- $ ls /Users/numa/blast/db/swissprot
- swissprot.fa swissprot.phd swissprot.phi swissprot.phr swissprot.pin swissprot.pog swissprot.psd swissprot.psi swissprot.psq
- $ blastp -query test.fa -db /Users/numa/blast/db/swissprot/swissprot
- Otherwise (setting just path to db directory /path/to/db/), you will get foloowing error.
- ```Bash:
- $ blastp -query test.fa -db /Users/numa/blast/db/swissprot
- BLAST Database error: No alias or index file found for protein database [/Users/numa/blast/db/swissprot] in search path [/Users/numa/blast/db::]
Art Puzzles is an Android Puzzle app that is developed by Viridesoft and published on Google play store on NA. It has already got around 1000 so far with an average rating of 4.0 out of 5 in play store.
Art Puzzles requires Android OS version of 3.4 and up. Also, it has a content rating of Everyone from which one can decide if it is suitable to install for family, kids or adult users.
Mr. boxman mac os. Since Art Puzzles is an Android app and cannot be installed on Windows PC or MAC directly, we will show how to install and play Art Puzzles on PC below:
- Firstly, download and install an Android emulator to your PC
- Download Art Puzzles APK to your PC
- Open Art Puzzles APK using the emulator or drag and drop the .APK file into the emulator to install the app. OR
- If you do not want to download the .APK file you can still run Art Puzzles PC by connecting or configuring your Google account with the emulator and downloading the app from play store directly.
Brain Blast Mac Os Download
If you follow the above steps correctly, you should have the Art Puzzles app ready to run on your Windows PC or MAC.